Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Prnp Rabbit Polyclonal Antibody

SKU: orb331215

Description

Prnp Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Prnp. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Mouse Prnp. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Goat, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Goat, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Mouse Prnp
TargetPrnp
Protein SequenceSynthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF
Molecular Weight28kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AA960666 antibody, anti AI325101 antibody, anti CD230 antibody, anti PrP antibody, anti PrP antibody, anti PrPC antibody, anti PrPSc antibody, anti Prn-i antibody, anti Prn-p antibody, anti Sinc antibody, anti prP27-30 antibody, anti prP33-35C antibody

Similar Products

  • MDGA2 Rabbit Polyclonal Antibody [orb2939]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Human, Mouse, Sheep

    Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Prion protein PrP/PRNP Rabbit Polyclonal Antibody [orb334515]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PRNP Antibody [orb414909]

    ELISA,  IF,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Prion protein PrP/PRNP Rabbit Polyclonal Antibody [orb76308]

    IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PRNP Rabbit Polyclonal Antibody [orb630244]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Prnp Rabbit Polyclonal Antibody

Sample Type: Mouse Kidney lysates, Antibody dilution: 1.0 ug/ml.

Prnp Rabbit Polyclonal Antibody

Rabbit Anti-PRNP Antibody, Catalog Number: orb331215, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Plasma membrane and cytoplasm in Leydig cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_035300

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Prnp Rabbit Polyclonal Antibody (orb331215)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry