Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PSEN1 Rabbit Polyclonal Antibody

SKU: orb579084

Description

PSEN1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PSEN1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human PSEN1. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PSEN1
TargetPSEN1
Protein SequenceSynthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY
Molecular Weight53kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AD3, FAD, PS1, PS-1, S182, ACNINV3

Similar Products

  • PSEN1 Rabbit Polyclonal Antibody [orb584174]

    IHC,  IP,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • Presenilin 1 Rabbit Polyclonal Antibody [orb11306]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PSEN1 Antibody [orb44003]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Presenilin 1/PS-1/PSEN1/PS Rabbit Polyclonal Antibody [orb865718]

    ELISA,  FC,  ICC,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Presenilin 1 + 2 Rabbit Polyclonal Antibody [orb158199]

    IF,  IHC-Fr,  IHC-P,  WB

    Gallus, Human

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PSEN1 Rabbit Polyclonal Antibody

Brain, cerebellum

PSEN1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Liver, Antibody Dilution: 1 ug/ml.

PSEN1 Rabbit Polyclonal Antibody

WB Suggested Anti-PSEN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: OVCAR-3 cell lysate. PSEN1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000012

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PSEN1 Rabbit Polyclonal Antibody (orb579084)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry