PTGFR Rabbit Polyclonal Antibody

SKU: orb586157

Description

PTGFR Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PTGFR. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTGFR. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTGFR
• Target: PTGFR
• Protein Sequence: Synthetic peptide located within the following region: RFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMV
• Molecular Weight: 37kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FP

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PTGFR is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-PTGFR Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal kidney.

Quick Database Links

Gene Symbol

PTGFR

UniProt

P43088

RefSeq (Protein):NP_000950