PVRL2/CD112 Antibody

SKU: orb1536657

Description

PVRL2/CD112 Antibody

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IF, IHC, IHC-P, WB
• Dilution Range: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
• Reactivity: Human
• Application Notes:
  Further information: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa.

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
• Target: PVRL2 / CD112
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Concentration: 1.22 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2

Immunofluorescence analysis of HeLa cells.

Western blot analysis of extracts of various cell lines.

Quick Database Links

Gene Symbol

PVRL2 / CD112