PYCR2 Rabbit Polyclonal Antibody

SKU: orb582555

Description

PYCR2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PYCR2. It is suitable for IHC, IP, KO/KD Validated, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human PYCR2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

• Tested Applications: IHC, IP, KO/KD Validated, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR2
• Target: PYCR2
• Protein Sequence: Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE
• Molecular Weight: 34kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HLD10, P5CR2

Lanes: 1. 10 ug human fibroblast lysate, 2. 10 ug PYCR1 KO human fibroblast lysate, Primary Antibody dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: PYCR2.

PYCR2 antibody - middle region (orb582555) validated by WB using 293T cells lysate at 1 ug/ml.

Sample Type: 1. WT human fibroblast 2. PYCR1 KO human fibroblast, Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: PYCR2: Green DAPI:Blue, Gene Name: PYCR2.

WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

PYCR2

UniProt

Q96C36

RefSeq (Protein):NP_037460