Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RAB5A Rabbit Polyclonal Antibody

SKU: orb583217

Description

RAB5A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RAB5A. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human RAB5A. This antibody reacts with Human, Mouse, Zebrafish samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse, Zebrafish
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RAB5A
TargetRAB5A
Protein SequenceSynthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS
Molecular Weight24kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

RAB5

Similar Products

  • RAB5A/B/C Rabbit Polyclonal Antibody [orb1145802]

    ELISA,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RAB5A Rabbit Polyclonal Antibody [orb19552]

    ICC,  IF,  IHC-P,  WB

    Guinea pig, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Rab 5A rabbit pAb Antibody [orb767061]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Recombinant

    Unconjugated

  • RAB5A Antibody [orb50978]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RAB5A Rabbit Polyclonal Antibody [orb630447]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

RAB5A Rabbit Polyclonal Antibody

Sample type: zebra gut epithelial cells, Green: primary, Red: actin, Blue: DAPI, Primary dilution: 1:5000, Secondary dilution: 1:300.

RAB5A Rabbit Polyclonal Antibody

Sample type: zebra gut epithelial cells, Green: primary, Red: actin, Blue: DAPI, Primary dilution: 1:5000, Secondary dilution: 1:300.

RAB5A Rabbit Polyclonal Antibody

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

RAB5A Rabbit Polyclonal Antibody

WB Suggested Anti-RAB5A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004153

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RAB5A Rabbit Polyclonal Antibody (orb583217)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry