RAB8B Rabbit Polyclonal Antibody

SKU: orb584413

Description

RAB8B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RAB8B. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human RAB8B. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAB8B
• Target: RAB8B
• Protein Sequence: Synthetic peptide located within the following region: SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS
• Molecular Weight: 23kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FLJ38125

Sample Type: 1. Human Cervical Cancer Cell Lysate (15 ug), 2. Monkey Fibroblast Cell Lysate (15 ug), 3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP (15 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-Rabbit, Secondary dilution: 1:40000.

RAB8B antibody - C-terminal region (orb584413) validated by WB using HepG2 cell lysate at 1 ug/ml.

Quick Database Links

Gene Symbol

RAB8B

UniProt

Q92930

RefSeq (Protein):NP_057614