Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RACK1 Rabbit Polyclonal Antibody

SKU: orb577700

Description

RACK1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RACK1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human GNB2L1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GNB2L1
TargetRACK1
Protein SequenceSynthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW
Molecular Weight35kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1

Similar Products

  • RACK1 GNB2L1 Rabbit Polyclonal Antibody [orb234289]

    FC,  ICC,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RACK1 Antibody [orb521432]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RACK1 Rabbit Polyclonal Antibody [orb6794]

    ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Gallus, Mouse, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Rabbit RACK1 Antibody [orb1526438]

    IP,  WB

    Bovine, Gallus, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • RACK1 Rabbit Polyclonal Antibody [orb630477]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

RACK1 Rabbit Polyclonal Antibody

Sample Type: MCF-7 WT a whole cell lysates (110 UG), Primary Dilution: 1.5 mg/mL, Secondary Antibody: LI-COR Donkey anti-rabbit, Secondary Dilution: 1:10000. GNB2L1 is supported by BioGPS gene expression data to be expressed in MCF7.

RACK1 Rabbit Polyclonal Antibody

Rabbit Anti-GNB2L1 Antibody, Catalog Number: orb577700, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

RACK1 Rabbit Polyclonal Antibody

WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. GNB2L1 is supported by BioGPS gene expression data to be expressed in Jurkat.

RACK1 Rabbit Polyclonal Antibody

WB Suggested Anti-GNB2L1 antibody Titration: 1 ug/ml, Sample Type: Human liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006089

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RACK1 Rabbit Polyclonal Antibody (orb577700)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry