Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RAE1 Rabbit Polyclonal Antibody

SKU: orb330108

Description

RAE1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RAE1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human RAE1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human RAE1
TargetRAE1
Protein SequenceSynthetic peptide located within the following region: EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE
Molecular Weight40kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MIG14 antibody, anti MRNP41 antibody, anti Mnrp41 antibody, anti dJ481F12.3 antibody, anti dJ800J21.1 antibody

Similar Products

  • RAE1 Rabbit Polyclonal Antibody [orb865560]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RAE1 Rabbit Polyclonal Antibody [orb330109]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • RAE1 Antibody [orb1256826]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CHM Rabbit Polyclonal Antibody [orb1100672]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • RAE1 Rabbit Polyclonal Antibody [orb630491]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

RAE1 Rabbit Polyclonal Antibody

Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0 ug/mL using anti-RAE1 antibody (orb330108).

RAE1 Rabbit Polyclonal Antibody

Rabbit Anti-RAE1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

RAE1 Rabbit Polyclonal Antibody

WB Suggested Anti-RAE1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, RAE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RAE1 Rabbit Polyclonal Antibody (orb330108)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry