RAN Rabbit Polyclonal Antibody

SKU: orb330885

Description

RAN Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RAN. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human RAN. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAN
• Target: RAN
• Protein Sequence: Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA
• Molecular Weight: 24kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ARA24 antibody, anti Gsp1 antibody, anti TC4 antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Rabbit Anti-RAN Antibody, Catalog Number: orb330885, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RAN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

RAN

UniProt

P62826

RefSeq (Protein):NP_006316