RBBP8 Rabbit Polyclonal Antibody

SKU: orb581252

Description

RBBP8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RBBP8. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human RBBP8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RBBP8
• Target: RBBP8
• Protein Sequence: Synthetic peptide located within the following region: ETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEE
• Molecular Weight: 98kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RIM, COM1, CTIP, JWDS, SAE2, SCKL2

Sample Type: 1. HCT116 lysate (50 ug), 2. MCF7 lysate (50 ug), 3. rCtIP (30 ng), Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit IR700, Secondary dilution: 1:5000.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-RBBP8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

RBBP8

UniProt

A6NKN2

RefSeq (Protein):NP_976037