Recombinant Mouse VEGF-A

SKU: orb623194

Description

VEGF-A is member of the family of vascular endothelial growth factor (VEGF) proteins, which stimulate vasculogenesis and angiogenesis to restore oxygen supply to tissues. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF). Mouse VEGF-A Recombinant Protein is purified vascular endothelial growth factor A produced in yeast.

Research Area

Cardiovascular Research; Cell Biology

Images & Validation

• Application Notes:
  The Mouse IL-2 protein can be used in cell culture, as an IL-2 ELISA Standard, and as a Western Blot Control.

Key Properties

• Source: Yeast
• MW: 19.3 kDa
• Protein Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCC NDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCS ERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)

Storage & Handling

• Storage: -20°C
• Form/Appearance: Lyophilized
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only