RHBG Rabbit Polyclonal Antibody

SKU: orb330589

Description

RHBG Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RHBG. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human RHBG. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RHBG
• Target: RHBG
• Protein Sequence: Synthetic peptide located within the following region: RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR
• Molecular Weight: 47kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti SLC42A2 antibody

WB Suggested Anti-RHBG Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.

Quick Database Links

Gene Symbol

RHBG

UniProt

Q9H310

RefSeq (Protein):NP_065140