RHOC Rabbit Polyclonal Antibody

SKU: orb582865

Description

RHOC Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RHOC. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human RHOC. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Immunology & Inflammation

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RHOC
• Target: RHOC
• Protein Sequence: Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF
• Molecular Weight: 22kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

H9, ARH9, ARHC, RHOH9

Lanes: Lane 1: 20 ug of Brugia malayi total worm extract, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: RHOC.

Sample Type: Brugia malayi intestinal cross section, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-AP, Secondary Antibody dilution: 1:5000, Gene Name: RHOC.

WB Suggested Anti-RHOC Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

RHOC

UniProt

P08134

RefSeq (Protein):NP_786886