Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Runx2 Rabbit Polyclonal Antibody

SKU: orb573718

Description

Runx2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Runx2. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Rat. This antibody reacts with Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Mouse, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityRat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
TargetRunx2
Protein SequenceSynthetic peptide located within the following region: PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
Molecular Weight57 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Cbfa1, OSF-2

Similar Products

  • RUNX2 Rabbit Polyclonal Antibody [orb10256]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RUNX1 Rabbit Polyclonal Antibody [orb6903]

    FC,  WB

    Bovine, Canine, Equine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • RUNX2 Rabbit Polyclonal Antibody [orb576688]

    WB

    Bovine, Equine, Guinea pig, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • RUNX2 Rabbit Polyclonal Antibody [orb215912]

    ICC,  IF,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • RUNX2 Rabbit Polyclonal Antibody [orb312958]

    FC

    Bovine, Canine, Equine, Mouse, Porcine, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Runx2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Mouse and rat have 66 kDa, 65 kDa, 57 kDa and 51 kDa isoforms that contain this peptide sequence.

Runx2 Rabbit Polyclonal Antibody

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Two isoforms are present at ~70 kDa and ~54 kDa, peptide is present in several predicted isoforms for both Mouse and Rat.

Runx2 Rabbit Polyclonal Antibody

WB Suggested Anti-Runx2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Rat Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_445922

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Runx2 Rabbit Polyclonal Antibody (orb573718)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry