Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SATB1 Rabbit Polyclonal Antibody

SKU: orb576574

Description

SATB1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SATB1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human SATB1. This antibody reacts with Human samples and is predicted to react with Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityEquine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SATB1
TargetSATB1
Protein SequenceSynthetic peptide located within the following region: VDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD
Molecular Weight86 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DEFDA, KTZSL

Similar Products

  • SATB1 Rabbit Polyclonal Antibody [orb340974]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SATB1 Rabbit Polyclonal Antibody [orb413042]

    ELISA,  FC,  ICC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SATB1 Rabbit Polyclonal Antibody [orb11351]

    ELISA

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • SATB1 Rabbit Polyclonal Antibody [orb630976]

    ELISA,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-SATB1 (Ser47) Rabbit Polyclonal Antibody [orb6917]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Gallus, Porcine, Rabbit

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SATB1 Rabbit Polyclonal Antibody

Positive control (+): 293T (2T), Negative control (-): A549 (N03), Antibody concentration: 3 ug/ml.

SATB1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in 3 isoforms including 89 kDa, 86 kDa, and 78 kDa. The protein may be modified by phosphorylation and/or sumoylation.

SATB1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 0.625 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 6%-18%. SATB1 is supported by BioGPS gene expression data to be expressed in Jurkat.

SATB1 Rabbit Polyclonal Antibody

WB Suggested Anti-SATB1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. SATB1 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002962

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SATB1 Rabbit Polyclonal Antibody (orb576574)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry