Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SCN5A Rabbit Polyclonal Antibody

SKU: orb329836

Description

SCN5A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SCN5A. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human SCN5A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SCN5A
TargetSCN5A
Protein SequenceSynthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM
Molecular Weight222kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CDCD2 antibody, anti CMD1E antibody, anti CMPD2 antibody, anti HB1 antibody, anti HB2 antibody, anti HH1 antibody, anti IVF antibody, anti LQT3 antibody, anti Nav1.5 antibody, anti SSS1 antibody, anti VF1 antibody, anti HBBD antibody, anti ICCD antibody, anti PFHB1 antibody

Similar Products

  • SCN5A Rabbit Polyclonal Antibody [orb329799]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SCN5A Rabbit Polyclonal Antibody [orb329800]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SCN5A Antibody [orb684897]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SCN5A Antibody [orb523380]

    ELISA,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Nav-pan Rabbit Polyclonal Antibody [orb214555]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SCN5A Rabbit Polyclonal Antibody

Sample Tissue: Human A172 Whole Cell, Antibody Dilution: 1 ug/mL.

SCN5A Rabbit Polyclonal Antibody

Sample Type: MCF7 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

SCN5A Rabbit Polyclonal Antibody

WB Suggested Anti-SCN5A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: SW620 cell lysate, SCN5A is supported by BioGPS gene expression data to be expressed in SW620.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000326

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SCN5A Rabbit Polyclonal Antibody (orb329836)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry