Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SCP2 Rabbit Polyclonal Antibody

SKU: orb330861

Description

SCP2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SCP2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SCP2. This antibody reacts with Human samples and is predicted to react with Equine, Guinea pig, Mouse, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityEquine, Guinea pig, Mouse, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SCP2
TargetSCP2
Protein SequenceSynthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA
Molecular Weight35kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DKFZp686C12188 antibody, anti DKFZp686D11188 antibody, anti NLTP antibody, anti NSL-TP antibody, anti SCPX antibody, anti SCP-2 antibody, anti SCP-X antibody, anti SCP-CHI antibody

Similar Products

  • SCP-2 rabbit pAb Antibody [orb766721]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • SCP2 Antibody [orb352727]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • CTDSP2 Rabbit Polyclonal Antibody [orb182793]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Mouse, Porcine, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CTDSP2 Rabbit Polyclonal Antibody [orb626099]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SCP2 Rabbit Polyclonal Antibody [orb631013]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SCP2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

SCP2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

SCP2 Rabbit Polyclonal Antibody

WB Suggested Anti-SCP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SCP2 Rabbit Polyclonal Antibody (orb330861)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry