Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SH2D3C Rabbit Polyclonal Antibody

SKU: orb325835

Description

SH2D3C Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SH2D3C. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3C. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Immunology & Inflammation, Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3C
TargetSH2D3C
Protein SequenceSynthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE
Molecular Weight77kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Chat antibody, anti FLJ39664 antibody, anti NSP3 antibody, anti PRO34088 antibody, anti-SH2D3C antibody

Similar Products

  • SH2D3C Rabbit Polyclonal Antibody [orb631146]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SH2D3C Rabbit Polyclonal Antibody [orb1939969]

    ELISA,  FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • NSP3 Rabbit Polyclonal Antibody (FITC) [orb466977]

    ICC,  IF

    Bovine, Canine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

  • NSP3 Rabbit Polyclonal Antibody (Biotin) [orb461061]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

  • NSP3 Rabbit Polyclonal Antibody (PE-Cy5) [orb916633]

    ICC,  IF

    Bovine, Canine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    PE/Cy5

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SH2D3C Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

SH2D3C Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

SH2D3C Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

SH2D3C Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

SH2D3C Rabbit Polyclonal Antibody

WB Suggested Anti-SH2D3C Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_733745

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SH2D3C Rabbit Polyclonal Antibody (orb325835)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry