Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Slamf1 Rabbit Polyclonal Antibody

SKU: orb333736

Description

Slamf1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Slamf1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Mouse Slamf1. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Mouse Slamf1
TargetSlamf1
Protein SequenceSynthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR
Molecular Weight38kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CD 150 antibody, anti Cd150 antibody, anti CD150 antigen antibody, anti Cdw150 antibody, anti Estm51 antibody, anti Ipo 3 antibody, anti IPO-3 antibody, anti Ipo3 antibody, anti Signaling lymphocytic activation molecule antibody, anti Signaling lymphocytic activation molecule family member 1 antibody, anti Signaling lymphocytic activation molecule family member 1, isoform CRA_a antibody, anti Signaling lymphocytic activation molecule family member 1, isoform CRA_b antibody, anti Signaling lymphocytic activation molecule precursor antibody, anti Slaf1 antibody, anti SLAM family, member 1 antibody, anti Slamf 1 antibody, anti Slamf1 antibody, anti SLAMF1 protein antibody

Similar Products

  • CD150/SLAM Rabbit Polyclonal Antibody [orb101809]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Human, Porcine, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SLAM rabbit pAb Antibody [orb766884]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • SLAMF1 Antibody [orb51534]

    ELISA,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SLAM Polyclonal Antibody [orb1411491]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SLAM/CD150/SLAMF1 Rabbit Polyclonal Antibody [orb1097965]

    ELISA,  FC,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Slamf1 Rabbit Polyclonal Antibody

Sample Type: Mouse Spleen lysates, Antibody dilution: 1.0 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_038758

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Slamf1 Rabbit Polyclonal Antibody (orb333736)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry