C2orf18 Rabbit Polyclonal Antibody

SKU: orb580025

Description

C2orf18 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC35F6. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human C2orf18. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf18
• Target: SLC35F6
• Protein Sequence: Synthetic peptide located within the following region: GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVA
• Molecular Weight: 40kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ANT2BP, TANGO9, C2orf18

WB Suggested Anti-C2orf18 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Lung.

Quick Database Links

Gene Symbol

SLC35F6

UniProt

Q8N357

RefSeq (Protein):NP_060347