Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SLC39A5 Rabbit Polyclonal Antibody

SKU: orb330368

Description

SLC39A5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC39A5. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5
TargetSLC39A5
Protein SequenceSynthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti LZT-Hs7 antibody, anti MGC34778 antibody, anti ZIP5 antibody

Similar Products

  • SLC39A5 Rabbit Polyclonal Antibody [orb330369]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SLC39A5 Antibody [orb1238537]

    ELISA,  IF,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • SLC39A5 Antibody [orb525018]

    ELISA,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SLC39A5 Rabbit Polyclonal Antibody (Biotin) [orb454129]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Feline, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Biotin

  • SLC39A5 Rabbit Polyclonal Antibody (Cy5) [orb961771]

    ICC,  IF

    Bovine, Canine, Equine, Feline, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Cy5

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SLC39A5 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

SLC39A5 Rabbit Polyclonal Antibody

Human Liver

SLC39A5 Rabbit Polyclonal Antibody

Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

SLC39A5 Rabbit Polyclonal Antibody

Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

SLC39A5 Rabbit Polyclonal Antibody

Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Uterus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

SLC39A5 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC39A5 Antibody Titration: 0.5 ug/mL, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_775867

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SLC39A5 Rabbit Polyclonal Antibody (orb330368)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry