SLC5A7 Rabbit Polyclonal Antibody

SKU: orb330358

Description

SLC5A7 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC5A7. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of human SLC5A7. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human SLC5A7
• Target: SLC5A7
• Protein Sequence: Synthetic peptide located within the following region: ILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNL
• Molecular Weight: 63 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CHT, CHT1, CMS20, HMN7A

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. Two isoforms of SLC5A7 can be detected in these samples as indicated.

Sample Type: ACHN Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Quick Database Links

Gene Symbol

SLC5A7

UniProt

Q9GZV3

RefSeq (Protein):NP_001291934.1