Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SLC6A2 Rabbit Polyclonal Antibody

SKU: orb324969

Description

SLC6A2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC6A2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC6A2
TargetSLC6A2
Protein SequenceSynthetic peptide located within the following region: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV
Molecular Weight69 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti NAT1 antibody, anti NET antibody, anti NET1 antibody, anti SLC6A5 antibody

Similar Products

  • SLC6A2 Rabbit Polyclonal Antibody [orb324970]

    WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • SLC6A2 Rabbit Polyclonal Antibody [orb1175847]

    ELISA,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SLC6A2/NET Antibody [orb1535459]

    IHC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • NET1 Rabbit Polyclonal Antibody (FITC) [orb462265]

    ICC,  IF

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

  • NET1 Rabbit Polyclonal Antibody (PE-Cy5) [orb911141]

    ICC,  IF

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    PE/Cy5

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SLC6A2 Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Multiple isoforms can be identified with this antibody from 57-69 kDa in human and mouse tissues.

SLC6A2 Rabbit Polyclonal Antibody

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

SLC6A2 Rabbit Polyclonal Antibody

Application: Western blotting, Species + Tissue/Cell type: 1: 50 ug human placenta lysate, 2: 50 ug human placenta lysate, 3: 50 ug sheep placenta lysate, 4: 50 ug sheep placenta lysate, Primary antibody Dilution: 1:1000, Secondary antibody: Anti-rabbit HRP, Secondary antibody Dilution: 1:20000.

SLC6A2 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001034

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SLC6A2 Rabbit Polyclonal Antibody (orb324969)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry