SLC9A3 Rabbit Polyclonal Antibody

SKU: orb330345

Description

SLC9A3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC9A3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SLC9A3. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC9A3
• Target: SLC9A3
• Protein Sequence: Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
• Molecular Weight: 93kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MGC126718 antibody, anti MGC126720 antibody, anti NHE3 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. A shorter form of this protein also contains the peptide sequence at 91 kDa, and the protein may be phosphorylated and/or glycosylated.

Sample Tissue: Human RPMI-8226, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/mL.

WB Suggested Anti-SLC9A3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.

Quick Database Links

Gene Symbol

SLC9A3

UniProt

P48764

RefSeq (Protein):NP_004165