Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SMAD3 Rabbit Polyclonal Antibody

SKU: orb592839

Description

SMAD3 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SMAD3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3. This antibody reacts with Human, Mouse samples and is predicted to react with Canine, Guinea pig, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityCanine, Guinea pig, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
TargetSMAD3
Protein SequenceSynthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT
Molecular Weight48kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436

Similar Products

  • Phospho-Smad3 (Ser423 + Ser425) Rabbit Polyclonal Antibody [orb6983]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-Smad3 (Thr179) Rabbit Polyclonal Antibody [orb313112]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-Smad3 (Ser213) Rabbit Polyclonal Antibody [orb106193]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Guinea pig, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-Smad3 (Ser204) Rabbit Polyclonal Antibody [orb4684]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-Smad2/Smad3 (Thr8) Rabbit Polyclonal Antibody [orb186235]

    FC,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SMAD3 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

SMAD3 Rabbit Polyclonal Antibody

Human Pancrease

SMAD3 Rabbit Polyclonal Antibody

Rabbit Anti-SMAD3 Antibody, Catalog Number: orb592839, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

SMAD3 Rabbit Polyclonal Antibody

WB Suggested Anti-SMAD3 Antibody Titration: 2.0 ug/ml, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005893

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SMAD3 Rabbit Polyclonal Antibody (orb592839)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry