SMN2 Rabbit Polyclonal Antibody

SKU: orb326467

Description

SMN2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SMN2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of SMN2. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Goat, Mouse, Porcine, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Goat, Mouse, Porcine, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of SMN2
• Target: SMN2
• Protein Sequence: Synthetic peptide located within the following region: KHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSA
• Molecular Weight: 27kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti BCD541 antibody, anti C-BCD541 antibody, anti FLJ76644 antibody, anti MGC20996 antibody, anti MGC5208 antibody, anti SMN1 antibody, anti SMNC antibody

WB Suggested Anti-SMN2 Antibody, Titration: 1.0 ug/mL, Positive Control: Jurkat Whole Cell, SMN2 is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

SMN2

UniProt

Q16637

RefSeq (Protein):NP_075015