SOX5 Rabbit Polyclonal Antibody

SKU: orb329718

Description

SOX5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SOX5. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human SOX5. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SOX5
• Target: SOX5
• Protein Sequence: Synthetic peptide located within the following region: PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
• Molecular Weight: 84 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti L-SOX5 antibody, anti MGC35153 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 84, 83, 82, 71, and 42 kDa.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/mL.

Sample Type: HepG2 cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0 ug/mL, Peptide Concentration: 0.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.

WB Suggested Anti-SOX5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

SOX5

UniProt

P35711

RefSeq (Protein):NP_821078