Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SRP54 Rabbit Polyclonal Antibody

SKU: orb330132

Description

SRP54 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SRP54. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SRP54. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SRP54
TargetSRP54
Protein SequenceSynthetic peptide located within the following region: ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SCN8

Similar Products

  • SRP54 Antibody [orb25807]

    ELISA,  IF,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • SRP54 Rabbit Polyclonal Antibody [orb865469]

    ELISA,  FC,  ICC,  IF,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SRP54 Rabbit Polyclonal Antibody [orb631509]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SRP54 Rabbit Polyclonal Antibody [orb631510]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SRP54 Antibody [orb521597]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SRP54 Rabbit Polyclonal Antibody

Hum. Adult Placenta.

SRP54 Rabbit Polyclonal Antibody

Positive control (+): MCF7 (N10), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

SRP54 Rabbit Polyclonal Antibody

SRP54 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb330132 with 1:200 dilution. Western blot was performed using orb330132 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: SRP54 IP with orb330132 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

SRP54 Rabbit Polyclonal Antibody

WB Suggested Anti-SRP54 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003127

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SRP54 Rabbit Polyclonal Antibody (orb330132)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry