Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SRPRB Rabbit Polyclonal Antibody

SKU: orb330594

Description

SRPRB Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SRPRB. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human SRPRB. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SRPRB
TargetSRPRB
Protein SequenceSynthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Molecular Weight30 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti APMCF1 antibody

Similar Products

  • SRPRB Rabbit Polyclonal Antibody [orb1676559]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SRPRB Antibody [orb521601]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SRPRB Antibody [orb351625]

    ELISA,  IF,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SRPRB Rabbit Polyclonal Antibody [orb330595]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SRPRB Rabbit Polyclonal Antibody [orb631515]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SRPRB Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

SRPRB Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in 721_B.

SRPRB Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in HeLa.

SRPRB Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in Jurkat.

SRPRB Rabbit Polyclonal Antibody

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): NTERA-2 Cell Lysate (N27), Antibody concentration: 1 ug/ml.

SRPRB Rabbit Polyclonal Antibody

Rabbit Anti-SRPRB Antibody, Catalog Number: orb330594, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

SRPRB Rabbit Polyclonal Antibody

WB Suggested Anti-SRPRB Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate, SRPRB is supported by BioGPS gene expression data to be expressed in HeLa.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_067026

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SRPRB Rabbit Polyclonal Antibody (orb330594)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry