SUMF1 Rabbit Polyclonal Antibody

SKU: orb331269

Description

SUMF1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SUMF1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUMF1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUMF1
• Target: SUMF1
• Protein Sequence: Synthetic peptide located within the following region: SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT
• Molecular Weight: 41 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AAPA3037 antibody, anti FGE antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 34 kDa.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: PANC1 Whole cell lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

SUMF1

UniProt

Q8NBK3

RefSeq (Protein):NP_877437