Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

UNC84A Rabbit Polyclonal Antibody

SKU: orb325524

Description

UNC84A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SUN1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human UNC84A. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human UNC84A
TargetSUN1
Protein SequenceSynthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA
Molecular Weight90kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ12407 antibody, anti KIAA0810 antibody, anti MGC176649 antibody, anti SUN1 antibody, anti UNC84A antibody

Similar Products

  • SUN1 Rabbit Polyclonal Antibody [orb631646]

    ELISA,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SUN1 Rabbit Polyclonal Antibody [orb668317]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • UNC84A Rabbit Polyclonal Antibody [orb513375]

    ELISA,  IHC,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SUN1 Antibody [orb1254760]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UNC84A Rabbit Polyclonal Antibody

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

UNC84A Rabbit Polyclonal Antibody

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

UNC84A Rabbit Polyclonal Antibody

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 3 ug/mL.

UNC84A Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

UNC84A Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

UNC84A Rabbit Polyclonal Antibody

Sample Type: Mouse C2C12 cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: UNC84a: Green DAPI: Blue, Gene Name: UNC84A.

UNC84A Rabbit Polyclonal Antibody

WB Suggested Anti-UNC84A Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_079430

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

UNC84A Rabbit Polyclonal Antibody (orb325524)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry