Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SYDE1 Rabbit Polyclonal Antibody

SKU: orb578569
KO/KD
Validated
KO/KD Validated

Description

SYDE1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SYDE1. It is suitable for KO/KD Validated, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SYDE1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

Tested ApplicationsKO/KD Validated, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Guinea pig, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SYDE1
TargetSYDE1
Protein SequenceSynthetic peptide located within the following region: PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG
Molecular Weight80kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

7h3, SYD1

Similar Products

  • SYDE1 Antibody [orb1245609]

    ELISA,  KO/KD Validated,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SYDE1 Rabbit Polyclonal Antibody

Lanes: 1: 2 ug mouse SYDE1 transfected HEK293T lysate, 2: 15 ug untransfected HEK293T lysate, 3: 100 ug wild type mouse brain lysate, 4: 100 ug SYDE1 knock-out mouse brain lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit L-chain HRP, Secondary Antibody Dilution: 1:10000, Gene Name: SYDE1.

SYDE1 Rabbit Polyclonal Antibody

WB Suggested Anti-SYDE1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_149014

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SYDE1 Rabbit Polyclonal Antibody (orb578569)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry