Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TAC1 Rabbit Polyclonal Antibody

SKU: orb333728

Description

TAC1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TAC1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human TAC1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Yeast

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TAC1
TargetTAC1
Protein SequenceSynthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH
Molecular Weight13kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C-terminal-flanking peptide antibody, anti Neurokinin 1 antibody, anti Neurokinin 2 antibody, anti Neurokinin A antibody, anti Neurokinin alpha antibody, anti Neuromedin L antibody, anti Neuropeptide gamma antibody, anti Neuropeptide K antibody, anti NKA antibody, anti NKNA antibody, anti NPK antibody, anti PPT antibody, anti Protachykinin 1 precursor antibody, anti Substance K antibody, anti SubstanceP antibody, anti TAC1 antibody, anti TAC2 antibody, anti Tachykinin 1 antibody, anti Tachykinin 2 antibody, anti Tachykinin precursor 1 antibody, anti Tachykinin1 antibody

Similar Products

  • Substance P Rabbit Polyclonal Antibody [orb13610]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Substance P Rabbit Polyclonal Antibody [orb308740]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Substance P Rabbit Polyclonal Antibody [orb500982]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Guinea pig, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Neurokinin A Rabbit Polyclonal Antibody [orb500956]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Human, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • TACR2 Antibody [orb523268]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TAC1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

TAC1 Rabbit Polyclonal Antibody

WB Suggested Anti-TAC1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_054703

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TAC1 Rabbit Polyclonal Antibody (orb333728)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry