Tcfap4 Rabbit Polyclonal Antibody

SKU: orb324699

Description

Tcfap4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Tfap4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of mouse Tcfap4. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Tcfap4
• Target: Tfap4
• Protein Sequence: Synthetic peptide located within the following region: AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT
• Molecular Weight: 39kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AI642933 antibody, anti AP-4 antibody, anti D930048N17Rik antibody, anti Tfap4 antibody, anti Tcfap4 antibody, anti bHLHc41 antibody

WB Suggested Anti-Tcfap4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Mouse Thymus.

Quick Database Links

Gene Symbol

Tfap4

UniProt

Q9JIZ5

RefSeq (Protein):NP_112459