TGFB1 Rabbit Polyclonal Antibody

SKU: orb576457

Description

TGFB1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TGFB1. It is suitable for IF, IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Neuroscience, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IF, IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1
• Target: TGFB1
• Protein Sequence: Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
• Molecular Weight: 43kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Human Spleen

Immunofluorescent TGFB1 detection in mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml.

TGFB1 in human prostate cancer tissue was detected using HRP/AEC red color stain. Working dilutions: 5-10 ug/ml.

WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution. SP2/0 cell lysate.

Quick Database Links

Gene Symbol

TGFB1

UniProt

P04202

RefSeq (Protein):NP_035707