Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Thrb Rabbit Polyclonal Antibody

SKU: orb329902

Description

Thrb Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Thrb. It is suitable for ChIP, WB applications. The immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb. This antibody reacts with Mouse samples and is predicted to react with Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

Tested ApplicationsChIP, WB
ReactivityMouse
Predicted ReactivityRat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the n terminal region of mouse Thrb
TargetThrb
Protein SequenceSynthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY
Molecular Weight54
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MGC141269 antibody, anti MGC141270 antibody, anti Nr1a2 antibody, anti T3R[b] antibody, anti T3Rbeta antibody, anti Thrb1 antibody, anti Thrb2 antibody, anti c-erbAbeta antibody

Similar Products

  • THRB1 Rabbit Polyclonal Antibody [orb158598]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • THRB Rabbit Polyclonal Antibody [orb1291533]

    ELISA,  FC,  IF,  IHC-Fr,  IHC-P

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • THRB1 Rabbit Polyclonal Antibody (BF647) [orb1587020]

    FC,  IF

    Bovine, Gallus, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    BF647

  • Thrb Rabbit Polyclonal Antibody [orb329901]

    ChIP,  WB

    Bovine, Equine, Guinea pig, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • THRB Antibody [orb350748]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Thrb Rabbit Polyclonal Antibody

Application: ChIP, Sample Type: mouse liver tissue, Chromatin Used: 100 ug tissue, Antibody Used: 10 ug.

Thrb Rabbit Polyclonal Antibody

Application: ChIP, Sample Type: mouse liver tissue, Chromatin Used: 100 ug tissue, Antibody Used: 10 ug.

Thrb Rabbit Polyclonal Antibody

WB Suggested Anti-Thrb Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_033406

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
ChIP
Chromatin Immunoprecipitation
View Protocol

Thrb Rabbit Polyclonal Antibody (orb329902)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry