Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TIA1 Rabbit Polyclonal Antibody

SKU: orb330155
KO/KD
Validated
KO/KD Validated

Description

TIA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TIA1. It is suitable for KO/KD Validated, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human TIA1. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsKO/KD Validated, WB
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TIA1
TargetTIA1
Protein SequenceSynthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Molecular Weight42 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti TIA-1 antibody

Similar Products

  • TIA1 Antibody [orb1260872]

    IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • TIA1 Antibody [orb353063]

    ELISA,  IHC,  IP,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • TIA1 rabbit pAb Antibody [orb774266]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

  • TIA1 Rabbit Polyclonal Antibody [orb631891]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • TIA1 Rabbit Polyclonal Antibody [orb100996]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TIA1 Rabbit Polyclonal Antibody

50 ug HAP1 WT and TIA1 KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/200. (right) Ponceau S staining to verify protein transfer.

TIA1 Rabbit Polyclonal Antibody

HAP1 WT and TIA1 KO cells were labelled with a green or a far-red fluorescent dye, respectively. WT and KO cells were mixed and plated to a 1:1 ratio in a 96-well plate as a mosaic culture. Cells were stained with orb330155 at a dilution of 1/500. Bars = 10um.

TIA1 Rabbit Polyclonal Antibody

TIA1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330155 with 1:200 dilution. Western blot was performed using orb330155 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: TIA1 IP with orb330155 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

TIA1 Rabbit Polyclonal Antibody

TIA1 was immunoprecipitated from HAP1 WT cell lysates using 1 ug of orb330155 coupled to Dynabeads. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitated.

TIA1 Rabbit Polyclonal Antibody

WB Suggested Anti-TIA1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Thymus.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_071320

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TIA1 Rabbit Polyclonal Antibody (orb330155)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry