Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TRP53 Rabbit Polyclonal Antibody

SKU: orb333706
KO/KD
Validated
KO/KD Validated

Description

TRP53 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of TRP53. It is suitable for KO/KD Validated, WB applications. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsKO/KD Validated, WB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetTRP53
Protein SequenceSynthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR
Molecular Weight43kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti BCC7 antibody, anti FLJ92943 antibody, anti HGNC11998 antibody, anti LFS1 antibody, anti p53 antibody, anti p53 Cellular Tumor Antigen antibody, anti p53 tumor suppressor antibody, anti Phosphoprotein p53 antibody, anti Tp53 antibody, anti TRP53 antibody, anti Tumor protein 53 antibody, anti Tumor protein p53 antibody, anti TP53 antibody

Similar Products

  • P53 protein (wt-p53) Rabbit Polyclonal Antibody [orb11210]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • P53 (Acetyl K382) Rabbit Polyclonal Antibody [orb11497]

    FC,  IF,  IHC-Fr,  IHC-P

    Canine

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-P53 (Ser33) Rabbit Polyclonal Antibody [orb6596]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • P53 (FL-393) Rabbit Polyclonal Antibody [orb2664]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-P53 (Ser392) Rabbit Polyclonal Antibody [orb11212]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TRP53 Rabbit Polyclonal Antibody

WB Suggested Anti-TRP53 Antibody, Positive Control: Lane 1: 40 ug C57/B6 control mouse G.I, Lane 2: 40 ug C57/B6 mouse G.I. treated with Irinotecan, Lane 3: 40 ug p53 KO HCT-116 cells Lane 4: 40 ug C57/B6 mouse treated with 15 Gy ionizing radiation, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:2500.

TRP53 Rabbit Polyclonal Antibody

WB Suggested Anti-TRP53 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_035770

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TRP53 Rabbit Polyclonal Antibody (orb333706)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry