Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TSG101 Rabbit Polyclonal Antibody

SKU: orb576274

Description

TSG101 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of TSG101. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetTSG101
Protein SequenceSynthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
Molecular Weight43kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CC2, AI255943

Similar Products

  • TSG101 Rabbit Polyclonal Antibody [orb11527]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Tsg 101 rabbit pAb Antibody [orb770328]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

  • TSG101 Rabbit Polyclonal Antibody [orb669211]

    ELISA,  FC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • TSG101 Rabbit Polyclonal Antibody [orb576823]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • TSG101 Rabbit Polyclonal Antibody [orb515563]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TSG101 Rabbit Polyclonal Antibody

Sample Type: mouse fibroblast lusate (10 ug), Primary Dilution: 1:1000 (1% BSA), Secondary Dilution: 1:2000 (5% milk).

TSG101 Rabbit Polyclonal Antibody

Rabbit Anti-Tsg101 Antibody, Paraffin Embedded Tissue: Mouse Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

TSG101 Rabbit Polyclonal Antibody

WB Suggested Anti-TSG101 Antibody, Positive Control: Lane 1: 30 ug mouse brain lysate, Lane 2: 30 ug mouse brain lysate, Lane 3: 30 ug mouse brain lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:50000.

TSG101 Rabbit Polyclonal Antibody

WB Suggested Anti-TSG101 Antibody Titration: 1.25 ug/ml, Positive Control: NIH/3T3 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_068684

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

TSG101 Rabbit Polyclonal Antibody (orb576274)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry