Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TYRP1 Rabbit Polyclonal Antibody

SKU: orb325137

Description

TYRP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TYRP1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human TYRP1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TYRP1
TargetTYRP1
Protein SequenceSynthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
Molecular Weight61 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CAS2 antibody, anti CATB antibody, anti GP75 antibody, anti TRP antibody, anti TYRP antibody, anti b-PROTEIN antibody

Similar Products

  • TYRP1 Rabbit Polyclonal Antibody [orb402977]

    ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • TYRP1 Rabbit Polyclonal Antibody [orb158651]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • TYRP1 Rabbit Polyclonal Antibody [orb325135]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • TYRP1 Antibody [orb686164]

    ELISA,  IF

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Tyrp1 Rabbit Polyclonal Antibody [orb325136]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish

    Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TYRP1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein is expressed as 61 kDa preprotein and is processed to approximately 56 kDa. It is also highly glycosylated.

TYRP1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

TYRP1 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

TYRP1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL.

TYRP1 Rabbit Polyclonal Antibody

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

TYRP1 Rabbit Polyclonal Antibody

Sample Type: Human 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5.0 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

TYRP1 Rabbit Polyclonal Antibody

Rabbit Anti-TYRP1 Antibody, Paraffin Embedded Tissue: Human Skin, Antibody Concentration: 5 ug/mL.

TYRP1 Rabbit Polyclonal Antibody

WB Suggested Anti-TYRP1 Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000541

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

TYRP1 Rabbit Polyclonal Antibody (orb325137)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry