Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

UGT1A7 Rabbit Polyclonal Antibody

SKU: orb580734

Description

UGT1A7 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of UGT1A7. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityHuman

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7
TargetUGT1A7
Protein SequenceSynthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
Molecular Weight57kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

GNT1, UGT1, UDPGT, UGT1A, UGT1G, UGT-1A, UGT-1G, UGT1.1, UGT1.7, UGT1A1, UGT1-01, UGT1-07, hUG-BR1, UDPGT 1-7

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UGT1A7 Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

UGT1A7 Rabbit Polyclonal Antibody

Rabbit Anti-UGT1A7 Antibody, Catalog Number: orb580734, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

UGT1A7 Rabbit Polyclonal Antibody

WB Suggested Anti-UGT1A7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_061950

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

UGT1A7 Rabbit Polyclonal Antibody (orb580734)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry