VEGFR2 Antibody

SKU: orb334966

Description

Goat polyclonal to VEGFR2. VEGFR2 known as kinase insert domain receptor, is a type III receptor tyrosine kinase. This VEGF receptor has a key function in vascular development and regulation of vascular permeability.

Research Area

Cardiovascular Research; Cell Biology

Images & Validation

• Tested Applications: IF, WB
• Dilution Range: WB:1:500-1:2,000, IF:1:25-1:250
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. Antigen Sequence: SVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPF
• Target: Kinase insert receptor (a type III receptor tyrosine kinase)
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CD309, Fetal liver kinase 1, FLK1, Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1, VEGFR, VEGF receptor 2, Vascular endothelial growth factor receptor 2 antibody.

Western blot analysis using VEGFR2 antibody

Quick Database Links

Gene Symbol

Kinase insert receptor (a type III receptor tyrosine kinase)