Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Wdfy1 Rabbit Polyclonal Antibody

SKU: orb583576

Description

Wdfy1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Wdfy1. It is suitable for IHC, WB and is reactive with human, mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
TargetWdfy1
Protein SequenceSynthetic peptide located within the following region: ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA
Molecular Weight46 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Jr, Jr1, WDF1, FENS-1, ZFYVE17, mKIAA1435, 1700013B03Rik, 1700120F24Rik

Similar Products

  • WDFY1 Rabbit Polyclonal Antibody [orb389657]

    ICC,  IF,  IHC-P,  WB

    Guinea pig, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • FENS1 Rabbit Polyclonal Antibody [orb156858]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • FENS1/WDFY1 Rabbit Polyclonal Antibody [orb1289973]

    ELISA,  FC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • WDFY1 Rabbit Polyclonal Antibody [orb583575]

    WB

    Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • WDFY1 rabbit pAb Antibody [orb774618]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Wdfy1 Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 46 kDa is present as well as a second isoform around ~25 kDa.

Wdfy1 Rabbit Polyclonal Antibody

Rabbit Anti-Wdfy1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 10 ug/ml.

Wdfy1 Rabbit Polyclonal Antibody

Rabbit Anti-Wdfy1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 10 ug/ml.

Wdfy1 Rabbit Polyclonal Antibody

WB Suggested Anti-Wdfy1 Antibody, Titration: 1.0 ug/ml, Positive Control: Human kidney.

Wdfy1 Rabbit Polyclonal Antibody

WB Suggested Anti-Wdfy1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_081333

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Wdfy1 Rabbit Polyclonal Antibody (orb583576)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry