Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ZFP42 Rabbit Polyclonal Antibody

SKU: orb329864

Description

ZFP42 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ZFP42. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP42. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityHuman

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZFP42
TargetZFP42
Protein SequenceSynthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC
Molecular Weight35kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti REX1 antibody, anti ZNF754 antibody

Similar Products

  • Rex1/ZFP42 Rabbit Polyclonal Antibody [orb654388]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ZFP42 rabbit pAb Antibody [orb774238]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

  • ZFP42 Antibody [orb47175]

    ELISA,  IF,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • Zinc finger protein 754 Rabbit Polyclonal Antibody [orb101365]

    WB

    Bovine, Equine, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • ZFP42 Antibody [orb1242974]

    ELISA,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ZFP42 Rabbit Polyclonal Antibody

WB Suggested Anti-ZFP42 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

ZFP42 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

ZFP42 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

ZFP42 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

ZFP42 Rabbit Polyclonal Antibody

Sample Type: 721_B Whole cell lysates, Antibody Dilution: 1.0 ug/mL.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_777560

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ZFP42 Rabbit Polyclonal Antibody (orb329864)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry