Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ZMIZ1 Rabbit Polyclonal Antibody

SKU: orb330053

Description

ZMIZ1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ZMIZ1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human ZMIZ1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZMIZ1
TargetZMIZ1
Protein SequenceSynthetic peptide located within the following region: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFE
Molecular Weight115kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ13541 antibody, anti KIAA1224 antibody, anti MIZ antibody, anti RAI17 antibody, anti Zimp10 antibody, anti hZIMP10 antibody, anti ZIMP10 antibody, anti TRAFIP10 antibody

Similar Products

  • Retinoic acid induced 17 Rabbit Polyclonal Antibody [orb101781]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ZMIZ1 Antibody [orb524846]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • ZMIZ1 Antibody [orb422789]

    ELISA,  IF,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • ZMIZ1 Antibody [orb524847]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • ZMIZ1 Antibody [orb1238547]

    ELISA,  ICC,  IF,  WB

    Mouse

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ZMIZ1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 50 ug mouse retina extract, Lane 2: 50 ug mouse prostate extract, Lane 3: 50 ug mouse testis extract, Lane 4: 50 ug mouse colon extract, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:10000, Gene Name: ZMIZ1.

ZMIZ1 Rabbit Polyclonal Antibody

WB Suggested Anti-ZMIZ1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_065071

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ZMIZ1 Rabbit Polyclonal Antibody (orb330053)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry