Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CLIC1 Rabbit Polyclonal Antibody

SKU: orb575357

Description

CLIC1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of CLIC1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLIC1
TargetCLIC1
Protein SequenceSynthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST
Molecular Weight27kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

G6, CL1C1, NCC27, CLCNL1

Similar Products

  • CLIC1 Rabbit Polyclonal Antibody [orb575358]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • CLIC1 Rabbit pAb Antibody [orb763792]

    IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • CLIC1 Antibody [orb521238]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CLIC1 Rabbit Polyclonal Antibody [orb763159]

    ELISA,  FC,  WB

    Human, Monkey, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CLIC1 Rabbit Polyclonal Antibody [orb625857]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CLIC1 Rabbit Polyclonal Antibody

Sample Type: Purified Recombinant CLIC-1 protein Primary Dilution: 1:1000.

CLIC1 Rabbit Polyclonal Antibody

CLIC1 antibody - C-terminal region (orb575357) validated by WB using purified recombinant CLIC1 protein and transfected lysate.

CLIC1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug mouse renal epithelial lysate, Lane 2: 30 ug mouse renal epithelial lysate, Lane 3: 30 ug mouse renal epithelial lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: CLIC1.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001279

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CLIC1 Rabbit Polyclonal Antibody (orb575357)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry