Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CLIC1 Rabbit Polyclonal Antibody

SKU: orb575358

Description

CLIC1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of CLIC1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CLIC1
TargetCLIC1
Protein SequenceSynthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
Molecular Weight27 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

G6, CL1C1, NCC27, CLCNL1

Similar Products

  • CLIC1 Rabbit pAb Antibody [orb763792]

    IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • CLIC1 Antibody [orb521238]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CLIC1 Rabbit Polyclonal Antibody [orb575357]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • CLIC1 Rabbit Polyclonal Antibody [orb763159]

    ELISA,  FC,  WB

    Human, Monkey, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CLIC1 Rabbit Polyclonal Antibody [orb625857]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CLIC1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

CLIC1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

CLIC1 Rabbit Polyclonal Antibody

Human kidney

CLIC1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug mouse renal epithelial lysate, Lane 2: 30 ug mouse renal epithelial lysate, Lane 3: 30 ug mouse renal epithelial lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: CLIC1.

CLIC1 Rabbit Polyclonal Antibody

Sample Type: Purified Recombinant CLIC-1 Protein Primary dilution: 1:1000.

CLIC1 Rabbit Polyclonal Antibody

WB Suggested Anti-CLIC1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001279

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CLIC1 Rabbit Polyclonal Antibody (orb575358)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry