Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EIF4G2 Rabbit Polyclonal Antibody

SKU: orb577548

Description

EIF4G2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EIF4G2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human EIF4G2. This antibody reacts with Gallus, Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityGallus, Human
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human EIF4G2
TargetEIF4G2
Protein SequenceSynthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV
Molecular Weight39kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

P97, AAG1, DAP5, NAT1

Similar Products

  • EIF4G2 Rabbit Polyclonal Antibody [orb213886]

    IF,  IHC,  WB

    Bovine, Human, Monkey, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • P97/DAP5/EIF4G2 Rabbit Polyclonal Antibody [orb1676419]

    ELISA,  FC,  ICC,  IF,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • P97/DAP5/EIF4G2 Rabbit Polyclonal Antibody [orb1290016]

    ELISA,  FC,  ICC,  IF,  IP,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • EIF4G2 Antibody [orb687060]

    ELISA,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • EIF4G2 Antibody [orb675486]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

EIF4G2 Rabbit Polyclonal Antibody

Sample Type: 1. IAH30 cells (0.5x10^6 cells loaded), 2. DF-1 cells (0.5x10^6 cells loaded), Primary Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase, Secondary Dilution: 1:10000.

EIF4G2 Rabbit Polyclonal Antibody

Rabbit Anti-EIF4G2 Antibody, Catalog Number: orb577548, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

EIF4G2 Rabbit Polyclonal Antibody

WB Suggested Anti-EIF4G2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
RefSeqAAH14930

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

EIF4G2 Rabbit Polyclonal Antibody (orb577548)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry