Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SIP1 Rabbit Polyclonal Antibody

SKU: orb577517

Description

SIP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GEMIN2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SIP1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SIP1
TargetGEMIN2
Protein SequenceSynthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Molecular Weight30kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SIP1, SIP1-delta

Similar Products

  • ZEB2 Rabbit Polyclonal Antibody [orb330041]

    IHC,  WB

    Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • ZEB2 Rabbit Polyclonal Antibody [orb329735]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Smad Interacting Protein 1/ZEB2 Rabbit Polyclonal Antibody [orb215990]

    FC,  ICC,  IHC,  IHC-Fr,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Gemin 2 Rabbit Polyclonal Antibody [orb157105]

    IF,  IHC-Fr,  IHC-P,  WB

    Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SIP1 rabbit pAb Antibody [orb766320]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SIP1 Rabbit Polyclonal Antibody

Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/ml. GEMIN2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

SIP1 Rabbit Polyclonal Antibody

Sample Type: Human MCF7, Antibody Dilution: 1.0 ug/ml. GEMIN2 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

SIP1 Rabbit Polyclonal Antibody

WB Suggested Anti-SIP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate. GEMIN2 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SIP1 Rabbit Polyclonal Antibody (orb577517)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry